Skip to product information
1 of 1

TCblR/CD320, Mouse (HEK293, His)

TCblR/CD320, Mouse (HEK293, His)

Size

SKU:QM-0203690-01

£97.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs) . As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    54219 (Gene_ID) Q9Z1P5-1 (M1-G208) (Accession)

  • Smiles

    MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

  • Purity

    94.5

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203690-01
5 µgQM-0203690-01
£97.61/ea
£0.00
£97.61/ea £0.00
10 µgQM-0203690-02
10 µgQM-0203690-02
£136.63/ea
£0.00
£136.63/ea £0.00
20 µgQM-0203690-03
20 µgQM-0203690-03
£252.39/ea
£0.00
£252.39/ea £0.00
50 µgQM-0203690-04
50 µgQM-0203690-04
£406.69/ea
£0.00
£406.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TCblR/CD320, Mouse (HEK293, His)

TCblR/CD320, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.