TCblR/CD320, Rat (HEK293, Fc)

Name: TCblR/CD320, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0076843-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0076843-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) and is critical for cobalamin uptake and can influence cell physiology. At the plasma membrane, it is expressed on follicular dendritic cells (FDC), where it helps interact with germinal center B cells and promotes immune responses. TCblR/CD320 Protein, Rat (HEK293, Fc) is the recombinant rat-derived TCblR/CD320 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
362851 (Gene_ID) Q5HZW5/NP_001014223.1 (A29-A210) (Accession)
Smiles
APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRIEPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRCDGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNPNA
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0076843-01	5 µgQM-0076843-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0076843-02	10 µgQM-0076843-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0076843-03	50 µgQM-0076843-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0076843-04	100 µgQM-0076843-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

500 µgQM-0076843-05	500 µgQM-0076843-05 £946.67/ea	£0.00	Quantity	£946.67/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TCblR/CD320, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.