Skip to product information
1 of 1

TCL1A, Human (His)

TCL1A, Human (His)

Size

SKU:QM-0205521-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    8115 (Gene_ID) P56279 (A2-D114) (Accession)

  • Smiles

    AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205521-01
5 µgQM-0205521-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0205521-02
10 µgQM-0205521-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0205521-03
50 µgQM-0205521-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0205521-04
100 µgQM-0205521-04
£359.82/ea
£0.00
£359.82/ea £0.00
500 µgQM-0205521-05
500 µgQM-0205521-05
£990.41/ea
£0.00
£990.41/ea £0.00
1 mgQM-0205521-06
1 mgQM-0205521-06
£1,488.56/ea
£0.00
£1,488.56/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TCL1A, Human (His)

TCL1A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.