TDGF1, Human (HEK293, Fc)

Name: TDGF1, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0193595-01
Price: 238.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0193595-01

£238.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (HEK293, Fc) is the recombinant human-derived TDGF1 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
6997 (Gene_ID) P13385 (L31-S169) (Accession)
Smiles
LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0193595-01	10 µgQM-0193595-01 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

50 µgQM-0193595-02	50 µgQM-0193595-02 £614.98/ea	£0.00	Quantity	£614.98/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TDGF1, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.