Skip to product information
1 of 1

TEAD3, Human (His-SUMO)

TEAD3, Human (His-SUMO)

Size

SKU:QM-0196258-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TEAD3 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD3 Protein, Human (His-SUMO) is the recombinant human-derived TEAD3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    7005 (Gene_ID) Q99594 (M112-D435) (Accession)

  • Smiles

    MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0196258-01
5 µgQM-0196258-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0196258-02
10 µgQM-0196258-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0196258-03
50 µgQM-0196258-03
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TEAD3, Human (His-SUMO)

TEAD3, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.