Skip to product information
1 of 1

TECK/CCL25, Human

TECK/CCL25, Human

Size

SKU:QM-0194187-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25 (Q24-L150) protein expressed byE. coli[1][2].

  • Molecular Formula

    6370 (Gene_ID) O15444-1 (Q24-L150) (Accession)

  • Smiles

    MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0194187-01
10 µgQM-0194187-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0194187-02
50 µgQM-0194187-02
£481.32/ea
£0.00
£481.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TECK/CCL25, Human

TECK/CCL25, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.