Skip to product information
1 of 1

TECK/CCL25, Mouse

TECK/CCL25, Mouse

Size

SKU:QM-0027559-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    20300 (Gene_ID) O35903 (Q24-N144) (Accession)

  • Smiles

    QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0027559-01
2 µgQM-0027559-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0027559-02
10 µgQM-0027559-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0027559-03
50 µgQM-0027559-03
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0027559-04
100 µgQM-0027559-04
£548.15/ea
£0.00
£548.15/ea £0.00
500 µgQM-0027559-05
500 µgQM-0027559-05
£1,212.76/ea
£0.00
£1,212.76/ea £0.00
1 mgQM-0027559-06
1 mgQM-0027559-06
£1,765.58/ea
£0.00
£1,765.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TECK/CCL25, Mouse

TECK/CCL25, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.