Tenascin/Tnc, Mouse (HEK293, His-Myc)

Name: Tenascin/Tnc, Mouse (HEK293, His-Myc)
Brand: QuantiMol
SKU: QM-0169133-01
Price: 216.46 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0169133-01

£216.46 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.
Molecular Formula
21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)
Smiles
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169133-01	5 µgQM-0169133-01 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

10 µgQM-0169133-02	10 µgQM-0169133-02 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

50 µgQM-0169133-03	50 µgQM-0169133-03 £825.17/ea	£0.00	Quantity	£825.17/ea	£0.00

100 µgQM-0169133-04	100 µgQM-0169133-04 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Tenascin/Tnc, Mouse (HEK293, His-Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.