1 1

TEV Protease, Tobacco etch virus (S2256N, C-His)

TEV Protease, Tobacco etch virus (S2256N, C-His)

Size

QM-0192878-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The TEV protease is critical in aphid transmission and has proteolytic activity that cleaves the Gly-Gly dipeptide at its C terminus. In addition to proteolysis, it interacts with virions and aphid stylets, which is critical for aphid transmission. TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is the recombinant Virus-derived TEV Protease protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    1502321 (Gene_ID) NP_062908.1 (E2039-Q2279, S2256N) (Accession)

  • Smiles

    ESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMNKPEEPFQPVKEATQLMNELVYSQ

  • Purity

    97.5

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0192878-01
5 µgQM-0192878-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0192878-02
10 µgQM-0192878-02
£72.61/ea		 £0.00
£72.61/ea £0.00
50 µgQM-0192878-03
50 µgQM-0192878-03
£216.46/ea		 £0.00
£216.46/ea £0.00
100 µgQM-0192878-04
100 µgQM-0192878-04
£316.08/ea		 £0.00
£316.08/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

TEV Protease, Tobacco etch virus (S2256N, C-His)

TEV Protease, Tobacco etch virus (S2256N, C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.