TFF1, Human (P. pastoris, N-His)
TFF1, Human (P. pastoris, N-His)
SKU:QM-0116921
Request quote or documents

Product Details
-
Description
TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived TFF1 protein, expressed by P. pastoris , with N-6*His labeled tag.
-
Molecular Formula
7031 (Gene_ID) P04155 (E25-F84) (Accession)
-
Smiles
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
TFF1, Human (P. pastoris, N-His)
TFF1, Human (P. pastoris, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.