Skip to product information
1 of 1

TFF1, Human (P. pastoris, N-His)

TFF1, Human (P. pastoris, N-His)

Size

SKU:QM-0116921

Price on request
Quantity

Request quote or documents

View full details
  • Description

    TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (P. pastoris, N-His) is the recombinant human-derived TFF1 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Molecular Formula

    7031 (Gene_ID) P04155 (E25-F84) (Accession)

  • Smiles

    EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0116921
1 EachQM-0116921
£0.00/ea
£0.00
£0.00/ea £0.00

TFF1, Human (P. pastoris, N-His)

TFF1, Human (P. pastoris, N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.