Skip to product information
1 of 1

TFF2, Human (His)

TFF2, Human (His)

Size

SKU:QM-0194606-01

£69.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (His) is the recombinant human-derived TFF2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    7032 (Gene_ID) Q03403 (E24-Y129) (Accession)

  • Smiles

    EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

  • Purity

    95.4

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194606-01
5 µgQM-0194606-01
£69.50/ea
£0.00
£69.50/ea £0.00
10 µgQM-0194606-02
10 µgQM-0194606-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0194606-03
50 µgQM-0194606-03
£327.02/ea
£0.00
£327.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TFF2, Human (His)

TFF2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.