Skip to product information
1 of 1

TFIIF-associating CTD phosphatase, Mouse (Myc, His)

TFIIF-associating CTD phosphatase, Mouse (Myc, His)

Size

SKU:QM-0093047

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The TFIIF-related CTD phosphatase protein plays a key role in promoting RNA polymerase II activity by dephosphorylating "Ser-2" and "Ser-5" residues. This enhances the function of RNA polymerase II, allowing the protein to participate in the transcription process. TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His) is the recombinant mouse-derived TFIIF-associating CTD phosphatase protein, expressed by E. coli , with N-His, C-Myc labeled tag.

  • Molecular Formula

    67655 (Gene_ID) Q7TSG2-1 (H178-R341) (Accession)

  • Smiles

    HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0093047
1 EachQM-0093047
£0.00/ea
£0.00
£0.00/ea £0.00

TFIIF-associating CTD phosphatase, Mouse (Myc, His)

TFIIF-associating CTD phosphatase, Mouse (Myc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.