TFIIF-associating CTD phosphatase, Mouse (Myc, His)
TFIIF-associating CTD phosphatase, Mouse (Myc, His)
SKU:QM-0093047
Request quote or documents

Product Details
-
Description
The TFIIF-related CTD phosphatase protein plays a key role in promoting RNA polymerase II activity by dephosphorylating "Ser-2" and "Ser-5" residues. This enhances the function of RNA polymerase II, allowing the protein to participate in the transcription process. TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His) is the recombinant mouse-derived TFIIF-associating CTD phosphatase protein, expressed by E. coli , with N-His, C-Myc labeled tag.
-
Molecular Formula
67655 (Gene_ID) Q7TSG2-1 (H178-R341) (Accession)
-
Smiles
HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
TFIIF-associating CTD phosphatase, Mouse (Myc, His)
TFIIF-associating CTD phosphatase, Mouse (Myc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.