TFPI2, Human (HEK293, C-His)

Name: TFPI2, Human (HEK293, C-His)
Brand: QuantiMol
SKU: QM-0200501-01
Price: 111.63 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0200501-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.
Molecular Formula
7980 (Gene_ID) P48307 (D23-K213) (Accession)
Smiles
DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0200501-01	5 µgQM-0200501-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

10 µgQM-0200501-02	10 µgQM-0200501-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0200501-03	50 µgQM-0200501-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TFPI2, Human (HEK293, C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.