Skip to product information
1 of 1

TFPI2, Mouse (189a.a, HEK293, His)

TFPI2, Mouse (189a.a, HEK293, His)

Size

SKU:QM-0202391-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.

  • Molecular Formula

    21789 (Gene_ID) O35536 (L23-K211) (Accession)

  • Smiles

    LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWK

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202391-01
5 µgQM-0202391-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0202391-02
10 µgQM-0202391-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0202391-03
50 µgQM-0202391-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0202391-04
100 µgQM-0202391-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TFPI2, Mouse (189a.a, HEK293, His)

TFPI2, Mouse (189a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.