TGF alpha/TGFA, Human

Name: TGF alpha/TGFA, Human
Brand: QuantiMol
SKU: QM-0172833-01
Price: 97.0 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0172833-01

£97.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TGF-alpha Protein, Human is a 50-amino-acid polypeptide that binds to the epidermal growth factor (EGF) receptor and stimulates cell growth.
Molecular Formula
7039 (Gene_ID) P01135 (V40-A89) (Accession)
Smiles
VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0172833-01	10 µgQM-0172833-01 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0172833-02	50 µgQM-0172833-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

100 µgQM-0172833-03	100 µgQM-0172833-03 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TGF alpha/TGFA, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.