Skip to product information
1 of 1

TGFBR1/ALK-5, Human (HEK293, Fc)

TGFBR1/ALK-5, Human (HEK293, Fc)

Size

SKU:QM-0178965-01

£233.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TGFBR1/ALK-5 proteins cooperate with TGFBR2 to form dedicated receptors for TGFB1, TGFB2, and TGFB3, transmitting signals and coordinating different physiological and pathological processes. It induces cell cycle arrest, modulates mesenchymal cell dynamics, contributes to wound healing, and affects immunosuppression and carcinogenesis. TGFBR1/ALK-5 Protein, Human (HEK293, Fc) is the recombinant human-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    7046 (Gene_ID) P36897-1 (L34-E125) (Accession)

  • Smiles

    LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE

  • Purity

    97.83

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0178965-01
10 µgQM-0178965-01
£233.47/ea
£0.00
£233.47/ea £0.00
50 µgQM-0178965-02
50 µgQM-0178965-02
£565.16/ea
£0.00
£565.16/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TGFBR1/ALK-5, Human (HEK293, Fc)

TGFBR1/ALK-5, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.