TGFBR1/ALK-5, Human (HEK293, mFc-Avi)

Name: TGFBR1/ALK-5, Human (HEK293, mFc-Avi)
Brand: QuantiMol
SKU: QM-0182725-01
Price: 311.23 GBP
Availability: InStock

Size 20 µg 50 µg

SKU:QM-0182725-01

£311.23 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TGFBR1/ALK-5 proteins cooperate with TGFBR2 to form dedicated receptors for TGFB1, TGFB2, and TGFB3, transmitting signals and coordinating different physiological and pathological processes. It induces cell cycle arrest, modulates mesenchymal cell dynamics, contributes to wound healing, and affects immunosuppression and carcinogenesis. TGFBR1/ALK-5 Protein, Human (HEK293, mFc-Avi) is the recombinant human-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.
Molecular Formula
7046 (Gene_ID) P36897-1 (L34-E125) (Accession)
Smiles
LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0182725-01	20 µgQM-0182725-01 £311.23/ea	£0.00	Quantity	£311.23/ea	£0.00

50 µgQM-0182725-02	50 µgQM-0182725-02 £625.91/ea	£0.00	Quantity	£625.91/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TGFBR1/ALK-5, Human (HEK293, mFc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.