TGFBR2/TGF-beta RII, Mouse (HEK293, His)

Name: TGFBR2/TGF-beta RII, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0184658-01
Price: 107.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0184658-01

£107.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.
Molecular Formula
21813 (Gene_ID) Q62312-2 (I24-D159) (Accession)
Smiles
IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDHHHHHH
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0184658-01	10 µgQM-0184658-01 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0184658-02	50 µgQM-0184658-02 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TGFBR2/TGF-beta RII, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.