THSD1, Human (HEK293, His)

Name: THSD1, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0180436-01
Price: 72.61 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180436-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)
Smiles
EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180436-01	10 µgQM-0180436-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0180436-02	50 µgQM-0180436-02 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

THSD1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.