Thy1/CD90, Human (HEK293)

Name: Thy1/CD90, Human (HEK293)
Brand: QuantiMol
SKU: QM-0204654-01
Price: 64.33 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0204654-01

£64.33 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free.
Molecular Formula
7070 (Gene_ID) P04216/NP_006279.2 (Q20-C130) (Accession)
Smiles
QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204654-01	5 µgQM-0204654-01 £64.33/ea	£0.00	Quantity	£64.33/ea	£0.00

10 µgQM-0204654-02	10 µgQM-0204654-02 £98.13/ea	£0.00	Quantity	£98.13/ea	£0.00

50 µgQM-0204654-03	50 µgQM-0204654-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0204654-04	100 µgQM-0204654-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0204654-05	500 µgQM-0204654-05 £1,103.40/ea	£0.00	Quantity	£1,103.40/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Thy1/CD90, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.