Skip to product information
1 of 1

TIGIT, Mouse (118a.a, HEK293, Fc)

TIGIT, Mouse (118a.a, HEK293, Fc)

Size

SKU:QM-0109023

Price on request
Quantity

Request quote or documents

View full details
  • Description

    TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (118a.a, HEK293, Fc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    100043314 (Gene_ID) NP_001139797 (G26-T143) (Accession)

  • Smiles

    GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGT

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0109023
1 EachQM-0109023
£0.00/ea
£0.00
£0.00/ea £0.00

TIGIT, Mouse (118a.a, HEK293, Fc)

TIGIT, Mouse (118a.a, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.