TIGIT, Mouse (118a.a, HEK293, Fc)
TIGIT, Mouse (118a.a, HEK293, Fc)
SKU:QM-0109023
Request quote or documents

Product Details
-
Description
TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (118a.a, HEK293, Fc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
100043314 (Gene_ID) NP_001139797 (G26-T143) (Accession)
-
Smiles
GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGT
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
TIGIT, Mouse (118a.a, HEK293, Fc)
TIGIT, Mouse (118a.a, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.