TIM-1/KIM-1/HAVCR, Canine (HEK293, His)

Name: TIM-1/KIM-1/HAVCR, Canine (HEK293, His)
Brand: QuantiMol
SKU: QM-0075731-01
Price: 64.33 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0075731-01

£64.33 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TIM-1/KIM-1/HAVCR Protein, Canine (HEK293, His) is the recombinant canine-derived TIM-1/KIM-1/HAVCR, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
612069 (Gene_ID) NP_001192043/XP_854888.1 (Y21-S160) (Accession)
Smiles
YVQVNGVVGHPATLPCTYSTASGVTTMCWGRGACPISHCLEEIVWTNGSHVTFQKHLRYKLKGKLSEGDVSLTIENAAQTDSGQYCCRVEHRGWFNDMKLTLSLEIKPDGNGTVTQSSDGLWHNNQTHVSLAQNSWMTTS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0075731-01	5 µgQM-0075731-01 £64.33/ea	£0.00	Quantity	£64.33/ea	£0.00

10 µgQM-0075731-02	10 µgQM-0075731-02 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

50 µgQM-0075731-03	50 µgQM-0075731-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0075731-04	100 µgQM-0075731-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TIM-1/KIM-1/HAVCR, Canine (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.