Skip to product information
1 of 1

TIM-16, S. cerevisiae

TIM-16, S. cerevisiae

Size

SKU:QM-0091993

Price on request
Quantity

Request quote or documents

View full details
  • Description

    TIM-16 protein is an important component of the PAM complex, which uses ATP to promote the transfer of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix. TIM-16 Protein, S. cerevisiae is the recombinant TIM-16 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    853340 (Gene_ID) P42949 (T54-A119) (Accession)

  • Smiles

    TLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0091993
1 EachQM-0091993
£0.00/ea
£0.00
£0.00/ea £0.00

TIM-16, S. cerevisiae

TIM-16, S. cerevisiae is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.