Skip to product information
1 of 1

TIM-4/TIMD-4, Human (Biotinylated, HEK293, His)

TIM-4/TIMD-4, Human (Biotinylated, HEK293, His)

Size

SKU:QM-0084749-01

£604.04 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TIM-4/TIMD-4 protein is a multifunctional phosphatidylserine receptor involved in multiple immune response functions. It participates in phagocytosis of apoptotic cells and exerts a bimodal regulatory effect on T cell activation—inhibiting initial T cell activation while promoting the proliferation of activated T cells through AKT1 and ERK1/2 phosphorylation. TIM-4/TIMD-4 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    91937 (Gene_ID) AAH08988.1 (E25-L315) (Accession)

  • Smiles

    MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

  • Purity

    97.1

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0084749-01
20 µgQM-0084749-01
£604.04/ea
£0.00
£604.04/ea £0.00
100 µgQM-0084749-02
100 µgQM-0084749-02
£1,488.56/ea
£0.00
£1,488.56/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TIM-4/TIMD-4, Human (Biotinylated, HEK293, His)

TIM-4/TIMD-4, Human (Biotinylated, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.