Skip to product information
1 of 1

TIM-4/TIMD-4, Human (HEK293, His)

TIM-4/TIMD-4, Human (HEK293, His)

Size

SKU:QM-0186671-01

£117.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion and promots the engulfment against apoptotic cells or exogenous particles. TIM-4/TIMD-4 Protein, Human (HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    91937 (Gene_ID) AAH08988.1 (E25-L315) (Accession)

  • Smiles

    ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0186671-01
10 µgQM-0186671-01
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0186671-02
50 µgQM-0186671-02
£327.02/ea
£0.00
£327.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TIM-4/TIMD-4, Human (HEK293, His)

TIM-4/TIMD-4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.