TIMP-1, Mouse (HEK293)

Name: TIMP-1, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0173463-01
Price: 238.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0173463-01

£238.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.
Molecular Formula
21857 (Gene_ID) P12032 (C25-R205) (Accession)
Smiles
CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0173463-01	10 µgQM-0173463-01 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

50 µgQM-0173463-02	50 µgQM-0173463-02 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TIMP-1, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.