Tissue Factor, Rat (HEK293, His)

Name: Tissue Factor, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0181240-01
Price: 226.18 GBP
Availability: InStock

Size 10 µg 20 µg

SKU:QM-0181240-01

£226.18 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
25584 (Gene_ID) Q66HI4 (A29-E252) (Accession)
Smiles
MAIPMRPRLLAALAPTFLGFLLLQVAAGAGTPPGKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGTHGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVFGNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESITKCTEQWKSVLGE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0181240-01	10 µgQM-0181240-01 £226.18/ea	£0.00	Quantity	£226.18/ea	£0.00

20 µgQM-0181240-02	20 µgQM-0181240-02 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Tissue Factor, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.