Skip to product information
1 of 1

TL1A/TNFSF15, Mouse

TL1A/TNFSF15, Mouse

Size

SKU:QM-0184644-01

£221.31 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis[1][2]. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells[3]. The mouse TL1A protein has a transmembrane domain (40-60 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Protein, Mouse is the extracullar part of TL1A protein (I76-L252), produced in E.coli with tag free.

  • Molecular Formula

    326623 (Gene_ID) B2RR33/AAV33431.1 (I76-L252) (Accession)

  • Smiles

    ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0184644-01
10 µgQM-0184644-01
£221.31/ea
£0.00
£221.31/ea £0.00
50 µgQM-0184644-02
50 µgQM-0184644-02
£526.28/ea
£0.00
£526.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TL1A/TNFSF15, Mouse

TL1A/TNFSF15, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.