TLR4, Human (sf9, His, Solution)

Name: TLR4, Human (sf9, His, Solution)
Brand: QuantiMol
SKU: QM-0027589-01
Price: 152.38 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg 1 mg

SKU:QM-0027589-01

£152.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.
Molecular Formula
7099 (Gene_ID) O00206-1 (E24-K631) (Accession)
Smiles
ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
Purity
91.4
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0027589-01	10 µgQM-0027589-01 £152.38/ea	£0.00	Quantity	£152.38/ea	£0.00

50 µgQM-0027589-02	50 µgQM-0027589-02 £384.82/ea	£0.00	Quantity	£384.82/ea	£0.00

100 µgQM-0027589-03	100 µgQM-0027589-03 £573.15/ea	£0.00	Quantity	£573.15/ea	£0.00

1 mgQM-0027589-04	1 mgQM-0027589-04 £3,152.59/ea	£0.00	Quantity	£3,152.59/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TLR4, Human (sf9, His, Solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.