TMX2, Human (His)
TMX2, Human (His)
SKU:QM-0088305
Request quote or documents

Product Details
-
Description
The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
51075 (Gene_ID) Q9Y320-1 (M125-K296) (Accession)
-
Smiles
MTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
TMX2, Human (His)
TMX2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.