Skip to product information
1 of 1

TMX2, Human (His)

TMX2, Human (His)

Size

SKU:QM-0088305

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    51075 (Gene_ID) Q9Y320-1 (M125-K296) (Accession)

  • Smiles

    MTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0088305
1 EachQM-0088305
£0.00/ea
£0.00
£0.00/ea £0.00

TMX2, Human (His)

TMX2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.