TNF-alpha/TNFSF2, Marmota monax (sf9, His)

TNF-α/TNFSF2 protein is a cytokine secreted by macrophages that binds TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, acts as a potent pyrogen causing fever, and is associated with cachexia induction. TNF-alpha/TNFSF2 Protein, Marmota monax (sf9, His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by sf9 insect cells , with N-10*His labeled tag.

124109351 (Gene_ID) O35734 (G57-L233) (Accession)

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Room temperature in continental US; may vary elsewhere.