TNF-alpha/TNFSF2, Mouse (His)

Name: TNF-alpha/TNFSF2, Mouse (His)
Brand: QuantiMol
SKU: QM-0203059-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203059-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag.TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.
Molecular Formula
21926 (Gene_ID) P06804 (L80-L235) (Accession)
Smiles
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203059-01	2 µgQM-0203059-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203059-02	10 µgQM-0203059-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203059-03	50 µgQM-0203059-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0203059-04	100 µgQM-0203059-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TNF-alpha/TNFSF2, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.