Skip to product information
1 of 1

TNF RI/TNFRSF1A, Rat (HEK293, His)

TNF RI/TNFRSF1A, Rat (HEK293, His)

Size

SKU:QM-0202796-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Rat (HEK293, His) is expressed by HEK293 and has a transmembrane region (M1-A211) with a His tag at the C-terminus[1].

  • Molecular Formula

    25625 (Gene_ID) P22934/NP_037223.1 (L30-A211) (Accession)

  • Smiles

    LVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202796-01
2 µgQM-0202796-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202796-02
10 µgQM-0202796-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0202796-03
50 µgQM-0202796-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0202796-04
100 µgQM-0202796-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNF RI/TNFRSF1A, Rat (HEK293, His)

TNF RI/TNFRSF1A, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.