Skip to product information
1 of 1

TNF RII/TNFRSF1B, Cynomolgus/Rhesus Macaque (HEK293, His)

TNF RII/TNFRSF1B, Cynomolgus/Rhesus Macaque (HEK293, His)

Size

SKU:QM-0178949-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is expressed by HEK293 with 6*His tag at the C-terminus[1].

  • Molecular Formula

    102144224/715454 (Gene_ID) XP_005544817.1/F7EAF8 (L23-D257) (Accession)

  • Smiles

    LPAQVAFTPYAPEPGGTCRLREYYDQTAQMCCSKCPPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAQLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICHVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPAPSTAPGTSFLLPVGPSPPAEGSTGD

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0178949-01
10 µgQM-0178949-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0178949-02
50 µgQM-0178949-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNF RII/TNFRSF1B, Cynomolgus/Rhesus Macaque (HEK293, His)

TNF RII/TNFRSF1B, Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.