Skip to product information
1 of 1

TNF RII/TNFRSF1B, Human (183a.a, HEK293, mFc)

TNF RII/TNFRSF1B, Human (183a.a, HEK293, mFc)

Size

SKU:QM-0174703-01

£188.51 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Human (183a.a, HEK293, mFc) is expressed by HEK293 and has a transmembrane region (P24-T206) with mFc tag at the C-terminus[1].

  • Molecular Formula

    7133 (Gene_ID) P20333-1 (P24-T206) (Accession)

  • Smiles

    PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

  • Purity

    99.9

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0174703-01
10 µgQM-0174703-01
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0174703-02
50 µgQM-0174703-02
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNF RII/TNFRSF1B, Human (183a.a, HEK293, mFc)

TNF RII/TNFRSF1B, Human (183a.a, HEK293, mFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.