Skip to product information
1 of 1

TNFAIP8, Human (His)

TNFAIP8, Human (His)

Size

SKU:QM-0198780-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFAIP8 Protein functions as a negative regulator of apoptosis, inhibiting caspase-8 activity and suppressing TNF-mediated apoptosis without affecting procaspase-8 processing.This control prevents BID cleavage and subsequent caspase-3 activation, contributing to cellular survival mechanisms.TNFAIP8's role highlights its potential significance in apoptosis regulation and its implications for tumor development.TNFAIP8 Protein, Human (His) is the recombinant human-derived TNFAIP8 protein, expressed by E.coli , with N-His labeled tag.

  • Molecular Formula

    25816 (Gene_ID) O95379-1 (M1-I198) (Accession)

  • Smiles

    MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198780-01
5 µgQM-0198780-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0198780-02
10 µgQM-0198780-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0198780-03
50 µgQM-0198780-03
£288.14/ea
£0.00
£288.14/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNFAIP8, Human (His)

TNFAIP8, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.