TNFRSF10C, Human (HEK293, His)

Name: TNFRSF10C, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0193551-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0193551-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
8794 (Gene_ID) O14798 (A26-A221) (Accession)
Smiles
ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0193551-01	2 µgQM-0193551-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0193551-02	10 µgQM-0193551-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0193551-03	50 µgQM-0193551-03 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TNFRSF10C, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.