Skip to product information
1 of 1

TNFRSF11B/OPG, Human (CHO, Fc)

TNFRSF11B/OPG, Human (CHO, Fc)

Size

SKU:QM-0185216-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (CHO, Fc) is a recombinant human TNFRSF11B/OPG (E22-L201) with C-terminal hFc tag, which is produced in CHO cell[1][2].

  • Molecular Formula

    4982 (Gene_ID) O00300 (E22-L201) (Accession)

  • Smiles

    ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0185216-01
10 µgQM-0185216-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0185216-02
50 µgQM-0185216-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNFRSF11B/OPG, Human (CHO, Fc)

TNFRSF11B/OPG, Human (CHO, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.