Skip to product information
1 of 1

TNFRSF12A, Human

TNFRSF12A, Human

Size

SKU:QM-0027562-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human is the recombinant human-derived TNFRSF12A protein, expressed by E. coli , with tag free.

  • Molecular Formula

    51330 (Gene_ID) Q9NP84-1 (E28-P80) (Accession)

  • Smiles

    EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0027562-01
5 µgQM-0027562-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0027562-02
10 µgQM-0027562-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0027562-03
50 µgQM-0027562-03
£282.06/ea
£0.00
£282.06/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNFRSF12A, Human

TNFRSF12A, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.