Skip to product information
1 of 1

TNFRSF13B, Human

TNFRSF13B, Human

Size

SKU:QM-0027564-01

£115.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

  • Molecular Formula

    23495 (Gene_ID) O14836-1 (M1-V160) (Accession)

  • Smiles

    MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0027564-01
10 µgQM-0027564-01
£115.00/ea
£0.00
£115.00/ea £0.00
50 µgQM-0027564-02
50 µgQM-0027564-02
£299.07/ea
£0.00
£299.07/ea £0.00
100 µgQM-0027564-03
100 µgQM-0027564-03
£442.44/ea
£0.00
£442.44/ea £0.00
500 µgQM-0027564-04
500 µgQM-0027564-04
£1,427.81/ea
£0.00
£1,427.81/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNFRSF13B, Human

TNFRSF13B, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.