Skip to product information
1 of 1

TNFRSF3/LTBR, Cynomolgus (HEK293, Fc)

TNFRSF3/LTBR, Cynomolgus (HEK293, Fc)

Size

SKU:QM-0205668-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRSF3/LTBR Protein, Cynomolgus (HEK293, Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Cynomolgus (HEK293, Fc) is expressed by HEK293 cells and is a transmembrane protein (M225-W248) with a His tag at the C-terminus[1].

  • Molecular Formula

    712550 (Gene_ID) F6V995 (S28-M225) (Accession)

  • Smiles

    SQPQVVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGTM

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205668-01
2 µgQM-0205668-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0205668-02
10 µgQM-0205668-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0205668-03
50 µgQM-0205668-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0205668-04
100 µgQM-0205668-04
£370.76/ea
£0.00
£370.76/ea £0.00
500 µgQM-0205668-05
500 µgQM-0205668-05
£1,079.11/ea
£0.00
£1,079.11/ea £0.00
1 mgQM-0205668-06
1 mgQM-0205668-06
£1,798.38/ea
£0.00
£1,798.38/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNFRSF3/LTBR, Cynomolgus (HEK293, Fc)

TNFRSF3/LTBR, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.