Skip to product information
1 of 1

TNFRSF3/LTBR, Mouse (HEK293, Fc)

TNFRSF3/LTBR, Mouse (HEK293, Fc)

Size

SKU:QM-0184859-01

£137.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TNFRSF3/LTBR Protein, Mouse (HEK293, Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Mouse (HEK293, Fc) is expressed by HEK293 cells and is a transmembrane protein with a Fc tag at the C-terminus[1].

  • Molecular Formula

    17000 (Gene_ID) P50284 (S28-P218) (Accession)

  • Smiles

    SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0184859-01
10 µgQM-0184859-01
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0184859-02
50 µgQM-0184859-02
£415.71/ea
£0.00
£415.71/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TNFRSF3/LTBR, Mouse (HEK293, Fc)

TNFRSF3/LTBR, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.