1 1

TPO/Thrombopoietin, Cynomolgus (HEK293, His)

TPO/Thrombopoietin, Cynomolgus (HEK293, His)

Size

QM-0203052-01

£67.44 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    TPO/Thrombopoietin Protein is a major regulator of megakaryocyte production and platelet generation, signaling through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. Thrombopoietin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thrombopoietin protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    102144240 (Gene_ID) XP_005546625.1 (S22-G353) (Accession)

  • Smiles

    SPAPPACDPRVLSKLLRDSRVLHSRLSLCPEVNPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLLLVGGPTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLQKRQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHKLLNGTRGLFPGPSRRTLGAPDISPGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPSPVVQLHPLLPDPSAPTPTPTSPLLNTSHTHSQNLSQEG

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0203052-01
5 µgQM-0203052-01
£67.44/ea		 £0.00
£67.44/ea £0.00
10 µgQM-0203052-02
10 µgQM-0203052-02
£101.50/ea		 £0.00
£101.50/ea £0.00
50 µgQM-0203052-03
50 µgQM-0203052-03
£288.14/ea		 £0.00
£288.14/ea £0.00
100 µgQM-0203052-04
100 µgQM-0203052-04
£426.65/ea		 £0.00
£426.65/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

TPO/Thrombopoietin, Cynomolgus (HEK293, His)

TPO/Thrombopoietin, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.