Skip to product information
1 of 1

TPO/Thrombopoietin, Human (HEK293)

TPO/Thrombopoietin, Human (HEK293)

Size

SKU:QM-0026513-01

£313.65 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. TPO/Thrombopoietin Protein, Human (HEK293) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293, with tag free.

  • Molecular Formula

    7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

  • Smiles

    SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0026513-01
20 µgQM-0026513-01
£313.65/ea
£0.00
£313.65/ea £0.00
50 µgQM-0026513-02
50 µgQM-0026513-02
£516.56/ea
£0.00
£516.56/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TPO/Thrombopoietin, Human (HEK293)

TPO/Thrombopoietin, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.