1 1

TPO/Thrombopoietin, Human (HEK293, C/N-His)

TPO/Thrombopoietin, Human (HEK293, C/N-His)

Size

QM-0193198-01

£238.32 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.

  • Molecular Formula

    7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

  • Smiles

    SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0193198-01
10 µgQM-0193198-01
£238.32/ea		 £0.00
£238.32/ea £0.00
50 µgQM-0193198-02
50 µgQM-0193198-02
£515.35/ea		 £0.00
£515.35/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

TPO/Thrombopoietin, Human (HEK293, C/N-His)

TPO/Thrombopoietin, Human (HEK293, C/N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.