Skip to product information
1 of 1

TPSAB1, Human (HEK293, His)

TPSAB1, Human (HEK293, His)

Size

SKU:QM-0171159-01

£238.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Tryptase alpha/beta 1 protein (TPSAB1) belongs to a family of trypsin-like serine proteases, and is enzymatically active and get involved in proteolysis only as heparin-stabilized tetramers, TPSAB1 is also resistant to all known endogenous proteinase inhibitors. Beta tryptase appears to be the main isoenzymes expressed in mast cells; while alpha tryptase is predominate in basophils. TPSAB1 Protein, Human (HEK293, His) is the recombinant human-derived TPSAB1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    / (Gene_ID) Q86TM8 (I31-P275) (Accession)

  • Smiles

    IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0171159-01
10 µgQM-0171159-01
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0171159-02
50 µgQM-0171159-02
£614.98/ea
£0.00
£614.98/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TPSAB1, Human (HEK293, His)

TPSAB1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.