Transmembrane protease serine 4, Mouse (His-SUMO)
Transmembrane protease serine 4, Mouse (His-SUMO)
SKU:QM-0109033
Request quote or documents
Product Details
-
Description
The transmembrane protease serine 4 (TMPRSS4) protein is a plasma membrane-anchored serine protease that is critical for activating molecular pathways. Its proteolytic activity directly processes pro-uPA/PLAU into its active form. Transmembrane protease serine 4 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Transmembrane protease serine 4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
-
Molecular Formula
214523 (Gene_ID) Q8VCA5 (K52-M435) (Accession)
-
Smiles
KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0086965-01 Sterile 10 mM Histidine, pH 5.5 buffer
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0009933-01 L-Histidine buffer, Sterile
- QM-0183109-01 ε-Poly-L-lysine (hydrochloride) (MV 2000-5000)
- QM-0131878-01 ε-Poly-L-lysine (MW 3800-4200) [CAS 28211-04-3]
- QM-0067179 γ-L-Glutamyl-S-allyl-L-cysteine [CAS 1299925-32-8]
- QM-0048489-01 β-N-methylamino-L-alanine (hydrochloride) (Standard) [CAS 16012-55-8]
- QM-0025942-01 Valylleucine (TFA) [CAS 27530-02-5]
- QM-0024513 γ-Glutamylornithine (Standard) [CAS 56523-61-6]
- QM-0024512 β-Lysine [CAS 4299-56-3]
Other industry favorites
- QM-0086965-01 Sterile 10 mM Histidine, pH 5.5 buffer
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0205375-01 γ-Glutamyl-S-allylcysteine [CAS 91216-95-4]
- QM-0204930-01 α-Methyl-DL-aspartic acid [CAS 2792-66-7]
- QM-0161381-01 β-1,3-N-Acetylglucosaminyltransferase 4
- QM-0162316-01 β-Alanine-15N [CAS 204451-53-6]
- QM-0013113 β-Hydroxybutyrate methionine
- QM-0005220-01 β-cyano-L-Alanine (Standard) [CAS 6232-19-5]
- QM-0161380-01 α-1,4-N-Acetylglucosaminyltransferase 4
- QM-0143593-01 Ziprasidone amino acid [CAS 1159977-64-6]
Transmembrane protease serine 4, Mouse (His-SUMO)
Transmembrane protease serine 4, Mouse (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.