1 1

Transthyretin/TTR, Cynomolgus (HEK293, His, Myc)

Transthyretin/TTR, Cynomolgus (HEK293, His, Myc)

Size

QM-0169247-01

£158.00 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Transthyretin (TTR) is a thyroid hormone-binding protein that may be involved in transporting thyroxine from the blood to the brain. As a homotetramer, TTR forms a dimer of dimers with a ligand-regulated central channel. Transthyretin/TTR Protein, Cynomolgus (HEK293, His, Myc) is the recombinant cynomolgus-derived Transthyretin/TTR protein, expressed by HEK293 , with N-6*His, N-Myc labeled tag.

  • Molecular Formula

    101864775 (Gene_ID) Q8HXW1 (G21-E147) (Accession)

  • Smiles

    GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0169247-01
5 µgQM-0169247-01
£158.00/ea		 £0.00
£158.00/ea £0.00
10 µgQM-0169247-02
10 µgQM-0169247-02
£274.26/ea		 £0.00
£274.26/ea £0.00
50 µgQM-0169247-03
50 µgQM-0169247-03
£629.04/ea		 £0.00
£629.04/ea £0.00
100 µgQM-0169247-04
100 µgQM-0169247-04
£1,015.41/ea		 £0.00
£1,015.41/ea £0.00
500 µgQM-0169247-05
500 µgQM-0169247-05
£2,620.43/ea		 £0.00
£2,620.43/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Transthyretin/TTR, Cynomolgus (HEK293, His, Myc)

Transthyretin/TTR, Cynomolgus (HEK293, His, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.