Skip to product information
1 of 1

TRAP1, Human (GST)

TRAP1, Human (GST)

Size

SKU:QM-0203780-01

£91.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    As a chaperone with ATPase activity, TRAP1 protein plays a crucial role in protecting mitochondrial function and polarization, especially downstream of PINK1 and mitochondrial complex I. TRAP1 acts as a negative regulator of mitochondrial respiration, affecting the balance between oxidative phosphorylation and aerobic glycolysis. TRAP1 Protein, Human (GST) is the recombinant human-derived TRAP1 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    10131 (Gene_ID) Q12931 (S60-E308) (Accession)

  • Smiles

    STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203780-01
5 µgQM-0203780-01
£91.38/ea
£0.00
£91.38/ea £0.00
10 µgQM-0203780-02
10 µgQM-0203780-02
£133.00/ea
£0.00
£133.00/ea £0.00
20 µgQM-0203780-03
20 µgQM-0203780-03
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0203780-04
50 µgQM-0203780-04
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TRAP1, Human (GST)

TRAP1, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.