TRIM24, Human (P. pastoris, His)
TRIM24, Human (P. pastoris, His)
SKU:QM-0082473
Request quote or documents

Product Details
-
Description
TRIM24 protein is a multifunctional coactivator that dynamically interacts with nuclear receptors and coactivators to influence target gene transcription. It binds preferentially to unmodified H3K4me0 and acetylated H3K23. TRIM24 Protein, Human (P. pastoris, His) is the recombinant human-derived TRIM24 protein, expressed by P. pastoris , with N-6*His labeled tag.
-
Molecular Formula
8805 (Gene_ID) O15164 (K891-K1012) (Accession)
-
Smiles
KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
TRIM24, Human (P. pastoris, His)
TRIM24, Human (P. pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.