Skip to product information
1 of 1

TRIM24, Human (P. pastoris, His)

TRIM24, Human (P. pastoris, His)

Size

SKU:QM-0082473

Price on request
Quantity

Request quote or documents

View full details
  • Description

    TRIM24 protein is a multifunctional coactivator that dynamically interacts with nuclear receptors and coactivators to influence target gene transcription. It binds preferentially to unmodified H3K4me0 and acetylated H3K23. TRIM24 Protein, Human (P. pastoris, His) is the recombinant human-derived TRIM24 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Molecular Formula

    8805 (Gene_ID) O15164 (K891-K1012) (Accession)

  • Smiles

    KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0082473
1 EachQM-0082473
£0.00/ea
£0.00
£0.00/ea £0.00

TRIM24, Human (P. pastoris, His)

TRIM24, Human (P. pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.